Giải mã phân đoạn A hệ gen các chủng virus gumboro phân lập ở Việt Nam nhằm cung cấp nguồn gen cho nghiên cứu vaccine thế hệ mới

Tài liệu Giải mã phân đoạn A hệ gen các chủng virus gumboro phân lập ở Việt Nam nhằm cung cấp nguồn gen cho nghiên cứu vaccine thế hệ mới: ... Ebook Giải mã phân đoạn A hệ gen các chủng virus gumboro phân lập ở Việt Nam nhằm cung cấp nguồn gen cho nghiên cứu vaccine thế hệ mới

pdf205 trang | Chia sẻ: huyen82 | Ngày: 09/12/2013 | Lượt xem: 1935 | Lượt tải: 7download
Tóm tắt tài liệu Giải mã phân đoạn A hệ gen các chủng virus gumboro phân lập ở Việt Nam nhằm cung cấp nguồn gen cho nghiên cứu vaccine thế hệ mới, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
2010VN22372 bé gi¸o dôc vµ ®µo t¹o Tr−êng ®¹i häc n«ng nghiÖp hµ néi Lª thÞ kim xuyÕn gi¶i m· ph©n ®o¹n a hÖ gen c¸c chñng virus gumboro PH¢N LËP ë viÖt nam NH»M cung cÊp nguån gen cho nghiªn cøu vaccine thÕ hÖ míi LuËn ¸n tiÕn sÜ n«ng nghiÖp Chuyªn ngµnh: Vi sinh vËt häc thó y M sè : 62 62 50 10 Ng−êi h−íng dÉn khoa häc: 1. PGS.TS. Lª Thanh Hßa 2. TS. NguyÔn B¸ Hiªn Hµ Néi - 2010 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 3 LỜI CAM ðOAN Tôi xin cam ñoan ñây là công trình nghiên cứu do chính tôi thực hiện. Các số liệu và kết quả nêu trong luận án là số liệu ñầu tiên, hoàn toàn trung thực, chưa ñược công bố trong bất kỳ công trình hay tạp chí nào khác ở trong nước cũng như ở nước ngoài. Mọi sự giúp ñỡ ñã ñược cảm ơn. Các thông tin, tài liệu trích trong luận án ñã ñược chỉ rõ nguồn gốc. Hà Nội, ngày tháng năm 2010 Nghiên cứu sinh Lê Thị Kim Xuyến Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 4 LỜI CẢM ƠN Tôi xin trân trọng bày tỏ lòng biết ơn sâu sắc ñến PGS.TS. Lê Thanh Hòa - Trưởng phòng Miễn dịch học, Viện Công nghệ sinh học, Viện Khoa học và Công nghệ Việt Nam là thầy trực tiếp hướng dẫn, tận tình chỉ bảo tôi trong suốt quá trình nghiên cứu, học tập và hoàn thành luận án. Tôi xin chân thành cảm ơn TS. Nguyễn Bá Hiên - Trưởng Bộ môn Vi sinh vật - Truyền nhiễm, Khoa Thú y, Trường ðại học Nông nghiệp Hà Nội, thầy ñồng hướng dẫn, ñã tận tình giúp ñỡ tôi trong suốt thời gian học tập và nghiên cứu. Tôi xin cảm ơn sự hỗ trợ kinh phí của Bộ Khoa học và Công nghệ cho ñề tài cấp Nhà nước KC.04.29 (2004 - 2006). Tôi xin chân thành cảm ơn: - Tập thể các anh chị em Phòng Miễn dịch học - Viện Công nghệ Sinh học - là nơi tôi công tác và cũng chính là nơi học tập nghiên cứu, ñã giúp tôi hoàn thành công việc nghiên cứu của mình. - Tập thể các thầy cô giáo Bộ môn Vi sinh vật - Truyền nhiễm, Khoa Thú y, Trường ðại học Nông nghiệp Hà Nội ñã tạo mọi ñiều kiện thuận lợi cho tôi trong thời gian sinh hoạt học tập tại Bộ môn. - TS. Nguyễn Bá Thành, PGS.TS. ðinh Thị Bích Lân và các ñồng nghiệp ñã giúp ñỡ tôi trong quá trình thu thập mẫu bệnh phẩm. - Viện ðào tạo Sau ñại học và các cán bộ phụ trách ñào tạo ñã tạo mọi ñiều kiện thuận lợi cho tôi trong suốt thời gian nghiên cứu và học tập. Cuối cùng tôi muốn bày tỏ lòng biết ơn sâu sắc ñến những người thân trong gia ñình ñã luôn khuyến khích, ñộng viên cũng như chia sẻ những khó khăn với tôi trong suốt quá trình học tập và hoàn thành nghiên cứu của mình. Xin chân thành cảm ơn. Tác giả Lê Thị Kim Xuyến Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 5 MỤC LỤC Trang Trang phụ bìa Lời cam ñoan Mục lục Danh mục các ký hiệu, các chữ viết tắt Danh mục các bảng Danh mục các hình vẽ, ñồ thị MỞ ðẦU............................................................................................................. 1 Chương 1. TỔNG QUAN TÀI LIỆU.................................................................. 4 1.1. ðẠI CƯƠNG VỀ BỆNH GUMBORO......................................................... 4 1.1.1. Lịch sử và ñịa dư bệnh.................................................................. 5 1.1.2. Nguyên nhân gây bệnh.................................................................. 6 1.1.3. Cơ chế sinh bệnh........................................................................... 8 1.1.4. Triệu chứng lâm sàng.................................................................... 10 1.1.5. Bệnh tích....................................................................................... 10 1.1.6. Chẩn ñoán bệnh............................................................................. 13 1.1.7. Phòng bệnh Gumboro................................................................... 13 1.2. SINH HỌC PHÂN TỬ VIRUS GUMBORO......................................................... 15 1.2.1. Hệ gen của virus Gumboro.................................................................... 16 1.2.2. Protein của virus - cấu trúc và chức năng....................................... 19 1.2.3. Kháng nguyên của virus Gumboro....................................................... 26 1.2.4. Cơ chế phân tử quá trình nhân lên của IBDV…………………... 28 1.2.5. Cơ chế phân tử của quá trình “chết theo chương trình” (apoptosis) và hậu quả do virus Gumboro gây ra………………. 31 1.2.6. Epitope và sự biến ñổi tính kháng nguyên và ñộc lực..................... 34 1.3. CÁC CHỈ THỊ DI TRUYỀN PHÂN TỬ TRONG NGHIÊN CỨU VIRUS GUMBORO.................................................................................................... 40 1.3.1. Phản ứng RT-PCR thông dụng trong nghiên cứu phân tử virus Gumboro.......................................................................................... 40 1.3.2. Chỉ thị di truyền sử dụng vùng “siêu biến ñổi”............................ 42 1.3.3. Chỉ thị di truyền sử dụng toàn bộ gen kháng nguyên VP2........... 43 1.4. TÌNH HÌNH NGHIÊN CỨU SINH HỌC PHÂN TỬ VIRUS GUMBORO Ở VIỆT NAM................................................................................................................................ 44 1.5. TẦM QUAN TRỌNG CỦA VIỆC GIẢI MÃ HỆ GEN VIRUS GUMBORO....................................................................................................... 48 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 6 Chương 2. NỘI DUNG, VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU..... 51 2.1. NỘI DUNG 51 2.1.1. Giải trình tự chuỗi nucleotide gen kháng nguyên VP2 và phân ñoạn A (VP2-4-3) của virus Gumboro phân lập tại Việt Nam 51 2.1.2. Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ các chủng Gumboro của Việt Nam và thế giới dựa trên các gen trong phân ñoạn A 51 2.1.3. Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ các chủng Gumboro của Việt Nam và thế giới dựa trên toàn bộ phân ñoạn A 52 2.2. VẬT LIỆU...................................................................................................... 52 2.3. PHƯƠNG PHÁP NGHIÊN CỨU.................................................................. 54 2.3.1 Phương pháp chọn và lấy mẫu 55 2.3.2. Phương pháp tách chiết RNA tổng số........................................... 55 2.3.3. Phương pháp RT-PCR.................................................................. 56 2.3.4. Phương pháp kiểm tra sản phẩm RT-PCR bằng ñiện di trên thạch agarose.............................................................................................. 57 2.3.5. Phương pháp tinh sạch sản phẩm RT-PCR .................................. 58 2.3.6. Phương pháp tạo dòng.................................................................. 58 2.3.7 Phương pháp thu nhận DNA ñích trong sản phẩm PCR/RT-PCR nhiều ñoạn............................................................................................... 63 2.3.8. Phương pháp cắt-nối-ghép DNA................................................... 64 2.3.9. Phương pháp giải trình tự.............................................................. 64 2.3.10 Phương pháp xử lý số liệu sử dụng các phần mềm tin-sinh học... 66 CHƯƠNG 3. KẾT QUẢ VÀ THẢO LUẬN...................................................... 71 3.1. KẾT QUẢ GIẢI TRÌNH TỰ CHUỖI NUCLEOTIDE GEN KHÁNG NGUYÊN VP2 VÀ PHÂN ðOẠN A (VP2-4-3)........................................... 71 3.1.1. Kết quả xác ñịnh mẫu bệnh phẩm cung cấp nguồn RNA hệ gen virus 71 3.1.2. Kết quả giải trình tự gen kháng nguyên VP2................................ 74 3.1.3. Kết quả giải trình tự phân ñoạn A................................................ 77 3.1.3.1. Giải trình tự phân ñoạn A chủng BDG23 từ mẫu bệnh phẩm thu nhận tại Bình Dương............................................. 78 3.1.3.2. Giải trình tự phân ñoạn A chủng GHUT-12 từ mẫu bệnh phẩm thu nhận tại Thừa Thiên-Huế....................................... 81 3.1.3.3. Giải trình tự phân ñoạn A từ chủng cường ñộc cổ ñiển G202 phân lập tại Hà Nội........................................................... 84 3.1.4. Danh sách ñăng ký Ngân hàng gen các chủng Gumboro.................. 86 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 7 3.2. PHÂN TÍCH SO SÁNH THÀNH PHẦN GEN, MỐI QUAN HỆ NGUỒN GỐC PHẢ HỆ CỦA CÁC CHỦNG GUMBORO VIỆT NAM VÀ THẾ GIỚI DỰA TRÊN CÁC GEN TRONG PHÂN ðOẠN A............................................... 89 3.2.1. PHÂN TÍCH GEN VP2......................................................................... 91 3.2.1.1. Về thành phần nucleotide, amino acid .................................. 91 3.2.1.2. Phân tích ñồng nhất (về nucleotide) và tương ñồng (về amino acid)............................................................................ 96 3.2.1.3. Phân tích mối quan hệ nguồn gốc phả hệ.............................. 100 3.2.2. PHÂN TÍCH GEN VP5......................................................................... 103 3.2.2.1. Về thành phần nucleotide và amino acid............................... 103 3.2.2.2. Phân tích ñồng nhất (về nucleotide) và tương ñồng (về amino acid)............................................................................ 106 3.2.2.3. Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP5 108 3.2.3. PHÂN TÍCH GEN VP4......................................................................... 109 3.2.3.1. Về thành phần nucleotide và amino acid .............................. 109 3.2.3.2. Phân tích ñồng nhất (về nucleotide) và tương ñồng (về amino acid)............................................................................ 112 3.2.3.3. Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP4.. 113 3.2.4. PHÂN TÍCH GEN VP3......................................................................... 115 3.2.4.1. Về thành phần nucleotide và amino acid .............................. 115 3.2.4.2. Phân tích ñồng nhất (về nucleotide) và tương ñồng (về amino acid) ........................................................................... 118 3.2.4.3. Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP3.. 119 3.3. PHÂN TÍCH SO SÁNH THÀNH PHẦN GEN, MỐI QUAN HỆ NGUỒN GỐC PHẢ HỆ CỦA CÁC CHỦNG GUMBORO VIỆT NAM VÀ THẾ GIỚI DỰA TRÊN TOÀN BỘ PHÂN ðOẠN A.............................................................. 121 3.3.1. Phân tích ñặc tính sử dụng nucleotide/amino acid ñể kiến tạo phân ñoạn A (VP2-4-3) ở 3 chủng BDG23, GHUT-12, G202..... 121 3.3.2. Về thành phần nucleotide và amino acid...................................... 124 3.3.3. Phân tích tỷ lệ ñồng nhất (về nucleotide) và tương ñồng (về amino acid) ................................................................................... 128 3.3.4. Phân tích mối quan hệ nguồn gốc phả hệ...................................... 130 3.4. THẢO LUẬN CHUNG 132 KẾT LUẬN VÀ KIẾN NGHỊ............................................................................. 140 DANH MỤC CÔNG TRÌNH CỦA TÁC GIẢ................................................... 142 TÀI LIỆU THAM KHẢO................................................................................... 143 PHỤ LỤC ........................................................................................................... 161 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 8 DANH MỤC CÁC KÝ HIỆU, CÁC CHỮ VIẾT TẮT Ký hiệu Tiếng Anh Tiếng Việt AGP Agar Gel Precipitation Phản ứng kết tủa khuếch tán trong thạch bp Base pair Cặp bazơ cDNA complementary DNA DNA bổ sung CEF Chicken Embryo fibroblast Môi trường tế bào xơ phôi gà một lớp CEK Chicken Embryo Kidney cells Môi trường tế bào thận thai gà CPE Cytopathic Effect Bệnh tích tế bào cv classical virulent Virus ñộc tính cổ ñiển Da dalton DNA Deoxyribonucleic acid Axit Deoxyribonucleic ELISA Enzym Linked Immunosorbent Assay Phản ứng hấp phụ miễn dịch liên kết với enzyme gs group-specific Kháng nguyên ñặc hiệu theo nhóm IBD Infectious Bursal Disease Bệnh viêm túi Fabricius truyền nhiễm IBDV Infectious Bursal Disease Virus Virus gây viêm túi Fabricius truyền nhiễm INF Interferon kDa kilo dalton m.o.i multiplicity of infection Tỷ lệ gây nhiễm ORF Open Reading Frame Khung ñọc mở RNA Ribonucleic Acid Axit ribonucleic RT-PCR Reverse transcriptase polymerase chain reaction SPF Special Pathogen Free Sạch mầm bệnh ts type-specific Kháng nguyên ñặc hiệu theo týp VN Virus Neutralization Phản ứng trung hòa VP Viral protein Protein của virus vvIBDV Very virulent Infectious Bursal Disease Virus Virus gây viêm túi Fabricius truyền nhiễm có ñộc lực cao Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 9 DANH MỤC CÁC BẢNG Bảng Nội dung Trang 2.1 Danh sách các mẫu bệnh phẩm Gumboro sử dụng nghiên cứu.............. 53 2.2 Thành phần phản ứng RT-PCR và chu trình nhiệt trong nghiên cứu sinh học phân tử virus Gumboro............................................................ 56 2.3 Các mồi sử dụng trong phản ứng RT-PCR và giải trình tự trong nghiên cứu virus Gumboro..................................................................... 57 3.1 Danh sách bản quyền ñăng ký gen VP2 và phân ñoạn A (VP2-4-3) trong Ngân hàng gen sử dụng trong nghiên cứu.................................... 87 3.2 Danh sách các chủng Gumboro Việt Nam và thế giới sử dụng các gen của phân ñoạn A trong phân tích so sánh thành phần gen và mối quan hệ nguồn gốc phả hệ.................................................................................. 88 3.3 Vị trí sai khác nucleotide (74/178) dẫn ñến sai khác amino acid của gen kháng nguyên VP2 (1356 bp) giữa 28 chủng so sánh..................... 93 3.4 55 vị trí sai khác amino acid của protein VP2 giữa 28 chủng so sánh........ 94 3.5 Sai khác về amino acid tại các vị trí quan trọng có vai trò quyết ñịnh về tính kháng nguyên và ñộc lực của virus Gumboro ở các chủng của Việt Nam và thế giới............................................................................................. 95 3.6 Tỷ lệ (%) ñồng nhất về nucleotide (trên ñường chéo) và tương ñồng về amino acid (dưới ñường chéo) của gen kháng nguyên VP2 ở các chủng Gumboro Việt Nam và thế giới................................................... 97 3.7 Tỷ lệ (%) tương ñồng về nucleotide (dưới ñường chéo) và amino acid (trên ñường chéo) của 16 chủng Gumboro trong nghiên cứu này (gen kháng nguyên VP2)………………………………………........................ 100 3.8 Các vị trí sai khác nucleotide dẫn ñên sai khác amino acid (21 trong số 28 sai khác) của gen mã hóa cho protein VP5 giữa 28 chủng so sánh..... 104 3.9 20 vị trí sai khác về amino acid của protein VP5 giữa 28 chủng so sánh 105 3.10 Tỷ lệ (%) ñồng nhất về nucleotide (trên ñường chéo) và tương ñồng amino acid (dưới ñường chéo) gen VP5 của các chủng Gumboro Việt Nam và thế giới...................................................................................... 107 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 10 3.11 Vị trí sai khác về nucleotide (26 trong số 109) dẫn ñên sai khác amino acid của gen VP4 giữa 15 chủng............................................................ 110 3.12 22 vị trí sai khác amino acid của protein enzyme VP4 giữa 15 chủng.......... 110 3.13 Vị trí sai khác nucleotide và amino acid ở VP4 giữa các chủng Âu - Mỹ và Châu Á...................................................................................................... 111 3.14 Tỷ lệ (%) ñồng nhất về nucleotide (trên ñường chéo) và tương ñồng về amino acid (dưới ñường chéo) của gen VP4 giữa 15 chủng so sánh. 112 3.15 Vị trí sai khác nucleotide (36 trong số 95) dẫn ñến sai khác amino acid của gen VP3 giữa 15 chủng so sánh............................................................. 117 3.16 25 vị trí sai khác amino acid của protein VP3 giữa 15 chủng so sánh.......... 117 3.17 Tỷ lệ (%) ñồng nhất về nucleotide (trên ñường chéo) và tương ñồng về amino acid (dưới ñường chéo) của gen VP3 ở các chủng Gumboro Việt Nam và thế giới.......................................................................................... 118 3.18 Thành phần nucleotide sử dụng trong VP2-4-3 (3039 nucleotide) ở phân ñoạn A của 3 chủng BDG23, GHUT-12 và G202........................... 122 3.19 Thành phần amino acid sử dụng trong polypeptide chung do VP2-4-3 mã hóa của 3 chủng BDG23, GHUT-12 và G202.................................... 123 3.20 Các vị trí có sai khác về nucleotide trong phân ñoạn A có ñộ dài 3039 bp giữa 3 chủng Gumboro của Việt Nam, lần lượt theo trật tự các gen VP2-VPx-VP4-VP3................................................................................... 126 3.21 Các vị trí sai khác amino acid của protein chung trong phân ñoạn A giữa các chủng Gumboro của Việt Nam và thế giới, lần lượt theo trật tự phân bố VP2-VPx-VP4-VP3........................................ ..................... 127 3.22 Tỷ lệ (%) ñồng nhất về nucleotide (trên ñường chéo) và tương ñồng về amino acid (dưới ñường chéo) của VP2-4-3 ở các chủng Gumboro Việt Nam và thế giới (Âu-Mỹ và Châu Á)............................................ 129 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 11 DANH MỤC CÁC HÌNH Hình Nội dung Trang 1.1 Vùng Gumboro, ñịa hạt Sussex bang Delaware của Mỹ, nơi ñầu tiên phát hiện bệnh Gumboro......................................................................... 6 1.2 Cấu trúc của hạt IBDV dưới kính hiển vi ñiện tử................................... 6 1.3 Virus Gumboro thường tập hợp thành từng cụm nằm trong tế bào lympho B bị nhiễm ................................................................................. 7 1.4 Bệnh tích túi Fabricius và hệ cơ.............................................................. 11 1.5 Ảnh vi thể của các tế bào ñại thực bào trong túi Fabricius bị virus Gumboro tấn công................................................................................... 12 1.6 Các hạt virus nhìn dưới kính hiển vi ñiện tử................................................. 15 1.7 Hệ gen của virus Gumboro bao gồm 2 phân ñoạn A và B nhìn dưới kính hiện vi ñiện tử................................................................................. 17 1.8 Sơ ñồ hệ gen và một số vùng quan trọng của IBDV serotype I và II 18 1.9 Các phân ñoạn A và B của hệ gen virus Gumboro qua ñiện di DNA và các thành phần protein qua ñiện di protein............................................. 20 1.10 Sơ ñồ minh hoạ hệ gen của virus Gumboro và quá trình tổng hợp protein cấu trúc........................................................................................................... 24 1.11 Quy luật biến ñổi epitope: cường ñộc -> ñộc lực yếu -> nhược ñộc và ngược lại............................................................................................................. 36 1.12 Sơ ñồ minh họa các bước của một chu kỳ phản ứng PCR...................... 42 2.1 Sơ ñồ nghiên cứu tổng quát ñể thu nhận các chuỗi gen……….............. 55 2.2 Cấu trúc của vector pCR®2.1TOPO (Invitrogen)……………………..... 59 2.3 Quy trình tách chiết plasmid tái tổ hợp……………………………....... 61 3.1 Sơ ñồ minh họa vùng “siêu biến ñổi” hệ gen IBDV và vị trí bám của cặp mồi GF-GR……………………………………………………....... 72 3.2 Kết quả ñiện di kiểm tra RNA tổng số, và sản phẩm RT-PCR sử dụng cặp mồi GF-GR………………………………………………............... 72 3.3 Kết quả ñiện di kiểm tra sản phẩm DNA plasmid tái tổ hợp bằng enzyme EcoRI………………………………………………………..... 73 3.4 Giản ñồ (chromatogram) một phần trình tự vùng “siêu biến ñổi” gen kháng nguyên VP2 của chủng BDG…………………………………... 74 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 12 3.5 Sơ ñồ minh họa gen VP2-4-3 trong hệ gen virus Gumboro và vị trí bám của cặp mồi GVF(Kz2) - GV2R trên gen VP2…………………... 76 3.6 Kết quả ñiện di sản phẩm RT-PCR nhân gen kháng nguyên VP2 và kiểm tra kết quả cắt DNA plasmid tái tổ hợp bằng enzyme giới hạn EcoRI………………………………………........................................... 77 3.7 Sơ ñồ minh họa phân ñoạn A hệ gen và vị trí các cặp mồi bám ñể thu nhận các ñoạn gen phân ñoạn A bằng RT-PCR……………………….. 78 3.8 Kết quả ñiện di sản phẩm RT-PCR phân ñoạn A hệ gen virus Gumboro mẫu BDG23………………………………………………… 79 3.9 Phân tích diễn giải thành phần nucleotide và amino acid của phân ñoạn A ở chủng BDG23………………………………………………………….. 81 3.10 Kết quả ñiện di sản phẩm RT-PCR phân ñoạn A hệ gen virus Gumboro mẫu GHUT-12 và DNA plasmid tái tổ hợp cắt kiểm tra bằng enzyme EcoRI…………………………………………………… 82 3.11 Phân tích diễn giải thành phần nucleotide và amino acid của phân ñoạn A ở chủng GHUT-12……………………………………………………….. 83 3.12 Kết quả ñiện di sản phẩm RT-PCR phân ñoạn A hệ gen virus Gumboro mẫu G202…………………………………………………… 84 3.13 Phân tích diễn giải thành phần nucleotide và amino acid của phân ñoạn A ở chủng G202……………………………………………………………. 86 3.14 Sơ ñồ minh hoạ vị trí các gen trong phân ñoạn A……………………... 90 3.15 Mối quan hệ nguồn gốc phả hệ giữa các chủng IBDV Việt Nam và thế giới trên cơ sở gen kháng nguyên VP2 về thành phần nucleotide và amino acid……………………………………………………………... 101 3.16 Mối quan hệ nguồn gốc phả hệ giữa các chủng IBDV Việt Nam và thế giới trên cơ sở gen VP5 về thành phần nucleotide và amino acid.......... 108 3.17 Mối quan hệ nguồn gốc phả hệ giữa các chủng IBDV Việt Nam và thế giới trên cơ sở gen VP4 về thành phần nucleotide và amino acid.... 114 3.18 Mối quan hệ nguồn gốc phả hệ giữa các chủng IBDV Việt Nam và thế giới trên cơ sở gen VP3 về thành phần nucleotide và amino acid.... 120 3.19 Mối quan hệ phả hệ giữa các chủng IBDV của Việt Nam và các chủng của thế giới trên cơ sở phân tích toàn bộ phân ñoạn A (VP2-4-3) về thành phần nucleotide và amino acid……….......................................... 131 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 1 MỞ ðẦU Bệnh Gumboro hay còn gọi là bệnh viêm túi Fabricius truyền nhiễm, là một bệnh truyền nhiễm cấp tính lây lan nhanh ở gia cầm non, chủ yếu ở gà và gà tây, do một loại virus gây ra, có tên gọi là virus gây viêm túi Fabricius truyền nhiễm, hay còn gọi là virus Gumboro. Bệnh gây thiệt hại rất lớn về mặt kinh tế cho người chăn nuôi. Ngày nay, bệnh Gumboro xảy ra ở hầu hết các vùng chăn nuôi tập trung trên thế giới và virus Gumboro gây bệnh có nhiều biến chủng khác nhau nhưng ñều thuộc về serotype I và II, trong ñó serotype I có mức ñộ ñộc lực và tính gây bệnh cao, còn serotyp II hầu như không có tính gây bệnh. Tại Việt Nam, bệnh Gumboro ñược chính thức phát hiện từ những năm 1980 dựa vào triệu chứng lâm sàng, bệnh tích, dịch tễ học (Bitay và cs, 1984) [3]. Từ ñó ñến nay, sau gần 30 năm phát hiện, mặc dù ñã có nhiều chương trình phòng chống và sử dụng nhiều loại vaccine, Gumboro vẫn là bệnh khó xử lý, xảy ra ngày càng trầm trọng và lan rộng trên toàn quốc, gây thiệt hại lớn. Virus Gumboro là loại virus có hệ gen là RNA (ribonucleic acid) gồm hai sợi dương (ds RNA) cuộn tròn ñược phân làm hai ñoạn riêng biệt nên virus Gumboro thuộc họ Birnaviridae (Dobos và cs, 1979) [55]. Hai phân ñoạn trong hệ gen RNA của virus Gumboro có tên gọi là phân ñoạn A và phân ñoạn B, ñều mang thông tin di truyền và có nhiệm vụ sinh tổng hợp 5 loại protein từ VP1 ñến VP5 (VP = viral protein) của virus, ñó là VP1, VP2, VP3, VP4, VP5 (Kibenge và cs, 1988) [92]. Phân ñoạn B có ñộ dài khoảng 2800 nucleotide có chứa bộ phận gen mã hóa cho protein VP1. Protein VP1 tham gia vào quá trình tái tạo virus Gumboro với chức năng enzyme xúc tác RNA-polymerase (Tacken và cs, 2002) [183]. Phân ñoạn A có ñộ dài khoảng 3200 nucleotide, mã hóa cho protein chung gồm VP2, 4, 3 và một protein khác khung ñọc là VP5, trong ñó VP2 là một protein kháng nguyên của virus Gumboro. VP2 có ñộ bảo tồn cao về thành phần nucleotide ở hai ñầu 5’ và 3’, nhưng lại có một vùng khoảng 500 nucleotide ở giữa của gen rất thay ñổi ở các chủng khác nhau, gọi là vùng “siêu biến ñổi” (hypervariable region) (Yuwen và cs, 2008) [211]. Thực chất tất cả quần thể virus Gumboro ñều thuộc họ Birnaviridae, nhưng VP2 của các chủng khác nhau có vùng “siêu biến ñổi” có thành phần amino Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 2 acid không ñồng nhất. Vùng này bao gồm 120 - 150 amino acid mà ở ñó có một số amino acid quan trọng, chúng là các amino acid khung cấu tạo nên epitope kháng nguyên và ñộc lực. Sự thay ñổi của một, hai hay vài amino acid ñược gọi là epitope trong vùng này có tính chất quyết ñịnh ñến sự kết hợp kháng thể do chúng hoặc do các chủng ñồng kháng nguyên khác kích thích sinh ra. Nếu không ñồng nhất về thành phần khung epitope, kháng nguyên vaccine sử dụng có thể kích thích sinh kháng thể với hàm lượng cao nhưng kháng thể này không thể hoặc không hoàn toàn trung hòa ñược chủng virus gây bệnh khác vì không có vị trí kết hợp kháng nguyên - kháng thể tương ứng, do sai lệch về epitope của vaccine với chủng cường ñộc gây bệnh, và như vậy mặc dù ñàn gà ñược tiêm vaccine nhưng bệnh vẫn nổ ra (Letzel và cs, 2007) [113]. ðứng trước tình hình này, việc nghiên cứu một loại vaccine ña chủng, mà ñặc biệt là vaccine thế hệ mới ñể phòng bệnh Gumboro cho ñàn gia cầm là hết sức cần thiết và trên thế giới hiện nay, nghiên cứu cơ bản và phát triển vaccine vẫn không ngừng ñược ñẩy mạnh, nhằm tiến tới có ñược những phương thức và loại hình vaccine tốt nhất phòng chống bệnh Gumboro (Müller và cs, 2003) [133]. Vaccine thế hệ mới hay còn gọi là vaccine công nghệ gen là sản phẩm kết quả của quá trình thao tác và can thiệp của kỹ thuật gen ñối với gen kháng nguyên của một hay nhiều loại vi sinh vật cần phòng chống, trong ñó có virus Gumboro ñang ngày càng ñược quan tâm. Nguồn nguyên liệu về gen và hệ gen của virus gây bệnh phải ñược phân lập, tách dòng, giải trình tự và phân tích ñặc tính sinh học phân tử của chúng, ñồng thời một khi nguồn gen ñó ñã ñược gài vào plasmid thì việc thu thập, lưu giữ làm nguyên liệu khung tạo nên thư viện gen ñể tiến hành các công ñoạn tiếp theo là kết sức thuận lợi. ðể có nguồn gen của một số chủng virus Gumboro có tại Việt Nam, từ ñó làm cơ sở dữ liệu cho nghiên cứu về gen và hệ gen của virus Gumboro, cũng như tạo nguồn nguyên liệu gen ñể có thể sử dụng cho các chế phẩm thế hệ mới (chế phẩm chẩn ñoán, vaccine thế hệ mới...), chúng tôi tiến hành nghiên cứu ñề tài: “Giải mã phân ñoạn A hệ gen các chủng virus Gumboro phân lập ở Việt Nam nhằm cung cấp nguồn gen cho nghiên cứu vaccine thế hệ mới”. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 3 Mục tiêu của ñề tài là: giải mã phân ñoạn A và gen VP2 của một số chủng Gumboro tại Việt Nam, lưu giữ gen kháng nguyên VP2 và phân ñoạn A trong plasmid, phân tích ñặc ñiểm sinh học phân tử của chúng nhằm có ñược dữ liệu và nguyên liệu cho nghiên cứu vaccine thê hệ mới. Ý nghĩa khoa học và thực tiễn của ñề tài Gumboro có thể ñược coi là một bệnh cổ ñiển của ngành chăn nuôi gà công nghiệp. Có nhiều công trình nghiên cứu về bệnh, virus gây bệnh và vaccin phòng bệnh song bệnh vẫn bùng phát. Ở Việt Nam, virus Gumboro cũng rất ña dạng và phức tạp do chúng ta nhập khẩu con giống từ nhiều nước khác nhau trên thế giới, khi có bệnh xảy ra chúng ta không biết ñược virus Gumboro ñang mắc thuộc chủng nào và vì thế việc phòng bệnh chưa ñạt hiệu quả như mong muốn. Việc nghiên cứu trình tự nucleotide toàn bộ hệ gen của virus ñã ñược thế giới công bố. Tại Việt Nam, cho ñến thời ñiểm chúng tôi nghiên cứu công trình này, chưa có một nghiên cứu nào về vấn ñề giải mã toàn bộ phân ñoạn A và hệ gen của virus Gumboro phân lập nội ñịa. Bằng việc thu thập các chủng virus Gumboro ñương nhiễm ở Việt Nam, xem xét sự biến ñổi về thành phần gen, tính kháng nguyên và ñộc lực, nguồn gốc và mối quan hệ phả hệ của các chủng virus này, sẽ giúp chúng ta có hướng tạo ra các chế phẩm ñể phòng bệnh này một cách hiệu quả. ðề tài ñược tiến hành tại Viện Công nghệ sinh học - Viện Khoa học và Công nghệ Việt Nam. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 4 CHƯƠNG 1 TỔNG QUAN TÀI LIỆU 1.1 ðẠI CƯƠNG VỀ BỆNH GUMBORO Bệnh Gumboro hay còn gọi là bệnh viêm túi Fabricius truyền nhiễm (Infectious Bursal Disease - IBD) là bệnh truyền nhiễm lây lan cấp tính ở gà con (2- 6 tuần tuổi). Nguyên nhân gây ra bệnh Gumboro là một loại virus RNA có tên là virus gây viêm túi truyền nhiễm (Infectious Bursal Disease Virus - IBDV) hay còn gọi là virus Gumboro. Sự nhiễm IBDV có thể làm gia tăng trầm trọng mức ñộ nhiễm bệnh với những tác nhân gây bệnh khác và làm giảm khả năng ñáp ứng miễn dịch của gia cầm. Các tế bào lympho trong túi Fabricius là những tế bào ñích của virus Gumboro. Gà ở ñộ tuổi 3 - 6 tuần có tính nhạy cảm cao với virus, khi túi Fabricius phát triển lớn nhất. Hậu quả của IBDV gây nhiễm ở gia cầm là làm teo nhỏ các mô lympho và cuối cùng là phá hủy cấu trúc túi Fabricius làm cho cơ quan có thẩm quyền miễn dịch này mất hoàn toàn hoặc một phần chức năng ñáp ứng miễn dịch dẫn ñến suy giảm miễn dịch (immunosuppression) (Sharma và cs, 2000) [167]; (Müller và cs, 2003) [133]. Virus ở các dạng ñộc lực cổ ñiển, nguyên nhân gây ra nhiều vụ dịch xảy ra trước ñây, thường gây ra tỷ lệ chết khoảng từ 1 - 50% số gà nhiễm trong ñàn (Müller và cs, 2003) [133]. Ở những ñàn gà thịt thương phẩm bị nhiễm, tỉ lệ này có thể lên ñến 50%, tuy nhiên ở các ñàn gà trong ñộ tuổi 3-6 tuần tỉ lệ chết ít khi vượt quá 3%. Người ta thấy rằng, khi thay thế các ñàn gà mái tơ Leghorn (thay ñàn) ở trong ñộ tuổi nhạy cảm với bệnh có thể làm gia tăng tỉ lệ chết của số gà nhiễm bệnh trong ñàn lên ñến 20% (Müller và cs, 2003) [133]. Trong các ñàn ñang ở thời kì ñẻ trứng, có sự giảm sút sản lượng trứng và cả chất lượng trứng. Bên cạnh khả năng gây chết, IBDV còn gây suy giảm miễn dịch ở gà bị nhiễm bệnh. Ở các ñàn gà thịt thương phẩm, sự suy giảm khả năng miễn dịch ñược biểu hiện rõ rệt bởi tỉ lệ xâm nhiễm cao của các virus ñường hô hấp và làm gia tăn._.g tỉ lệ chết do sự nhiễm trùng máu của vi khuẩn E. coli (trực khuẩn ruột già) trong suốt Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 5 một phần ba cuối của chu kỳ phát triển 6-8 tuần. Vaccine sống nhược ñộc có thể không phát huy tác dụng ở cả các ñàn gà thịt và ñàn gà mái tơ sau tiêm chủng nhằm chống lại với các bệnh ñường hô hấp như là bệnh viêm phế quản và bệnh Newcastle. Từ năm 1986 ñến nay, các chủng IBDV ñộc lực cao ñã gây ra nhiều vụ dịch lớn ở Châu Âu, bao gồm nhiều chủng có thể gây chết tới 70% số gà nhiễm bệnh trong các ñàn gà mái ñẻ (Van Den Berg, 1991; 2000) [192, 193]; (Zorman-Rojs và cs, 2003) [217]. Các chủng virus này có sự tương ñồng kháng nguyên với chủng virus “cổ ñiển” gây bệnh dịch Gumboro trong nhiều thập kỷ và có thể gây ra các tổn thương bệnh tích ñặc trưng (Eterradossi và cs, 1992) [60]. ðặc biệt, các chủng IBDV có ñộc lực cao (very virulent IBDV = vvIBDV) có khả năng “lẩn tránh” ñược ñáp ứng miễn dịch dịch thể sinh ra sau kích thích bằng chủng virus cổ ñiển (không bị trung hòa bởi các kháng thể này), khi xâm nhiễm và gây bệnh ở gà mẫn cảm. ðược phát hiện lần ñầu tiên cách ñây hơn 50 năm, cho ñến nay bệnh Gumboro vẫn ñang là mối ñe dọa nguy hiểm với ngành chăn nuôi gà công nghiệp ở khía cạnh suy giảm miễn dịch do virus gây ra. Sự thay ñổi tính kháng nguyên cũng như sự xuất hiện các chủng virus có tính gây bệnh cao trong nhiều ñàn gia cầm ñược tiêm vaccine (Dolz và cs, 2005) [58]; (Yuwen và cs, 2008) [211], ñã kích thích nỗ lực quan tâm nghiên cứu các chủng Gumboro mới xuất hiện cả về bệnh và nguyên nhân gây bệnh. 1.1.1 Lịch sử và ñịa dư bệnh IBDV là loại virus thuộc họ Birnaviridae, nhóm Birnavirus, ñược phát hiện ñầu tiên vào năm 1957 tại vùng Gumboro, ñịa hạt Sussex thuộc bang Delaware của Mỹ (Hình 1.1), nhưng mãi ñến năm 1962 mới ñược Cosgrove miêu tả cặn kẽ (Cosgrove, 1962) [50]. Năm 1970, Hitchner ñề nghị chính thức coi bệnh do Cosgrove phát hiện là bệnh viêm túi Fabricius truyền nhiễm (IBD) hay còn gọi là bệnh Gumboro ñể ghi nhớ ñịa danh phát hiện bệnh ñầu tiên (Hitchner, 1970) [73]. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 6 Hình 1.1: Vùng Gumboro, ñịa hạt Sussex bang Delaware của Mỹ, nơi ñầu tiên phát hiện bệnh Gumboro Từ khi ñược phát hiện ñến nay, bệnh ñã lan truyền nhanh chóng và rộng rãi trên nhiều nước có nền chăn nuôi gà công nghiệp phát triển. Ở Việt Nam bệnh ñược phát hiện năm 1984 (Bitay và cs, 1984) [3]. 1.1.2 Nguyên nhân gây bệnh 1.1.2.1 Hình thái, cấu trúc và phân loại virus gây bệnh Gumboro IBDV là một virus hoàn toàn mới, thành viên của nhóm Avibirnavirus thuộc họ Birnaviridae (Brown, 1986) [41], là một virus có kích thước không lớn, khoảng 58 - 60 nm, dạng hình khối ña diện cấu trúc ñối xứng 20 mặt (Dobos và cs, 1979) [55], (Hình 1.2). Hình 1.2: Cấu trúc của hạt IBDV dưới kính hiển vi ñiện tử (Nguồn: vir.sgmjournals.org/.../vol86/issue8/cover.shtml) Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 7 Trong nguyên sinh chất của tế bào bị nhiễm, dưới kính hiển vi ñiện tử, có thể quan sát thấy tập hợp virus Gumboro, xếp ñều ñặn cạnh nhau (Hình 1.3). Mỗi một nguyên sinh chất có thể chứa một vài tập hợp virus nói trên. Hình 1.3: Virus Gumboro thường tập hợp thành từng cụm nằm trong tế bào lympho B bị nhiễm (Nguồn: 210.36.18.48/gxujingpin/dwwswx/ev/16.htm) IBDV không có vỏ bọc ngoài cùng (envelop), mà chỉ là virus dạng trần, hay còn gọi là nucleocapsid, bao gồm nhân chứa ribonucleic acid (RNA) và bao quanh hệ gen là lớp vỏ protein hay còn gọi là capsid. Vỏ capsid của virus bao gồm 32 ñơn vị hình thái, mà mỗi một ñơn vị hình thái còn ñược gọi là capsomer ñan chéo nhau tạo thành (Hirai và cs, 1979) [72]. Mỗi capsomer ñược tạo thành bởi 4 loại protein khác nhau (Dobos, 1979) [54]. Các nucleotide trong ribonucleic acid (RNA) của virus Gumboro ñược xếp thành ñôi cuộn tròn và phân làm hai ñoạn riêng biệt (Becht và cs, 1988) [35]; (Müller và cs, 1979) [128]; (Müller và Lange, 1985) [130], ñây là một ñặc ñiểm hết sức ñặc trưng của loại virus này do vậy, theo sự phân loại mới nhất hiện nay, IBDV ñược xếp vào nhóm virus có chứa RNA và là thành viên ñại diện ñầu tiên của nhóm Avibirnavirus (Leong và cs, 2000) [112]. 1.1.2.2 Phân type huyết thanh học Cho ñến nay người ta coi tất cả các loại IBDV thuộc 2 serotype: I và II. Hai serotype của IBDV có thể ñược phân biệt bằng phản ứng trung hòa virus (McFerran và cs, 1980) [123]. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 8 Serotype I bao gồm các chủng virus cường ñộc Gumboro gây bệnh cho gà, mà tùy thuộc vào mức ñộ ñộc lực, người ta phân ra làm 4 nhóm chính: nhóm cường ñộc cao (very virulent group), nhóm cổ ñiển (classical group), nhóm biến ñổi (variant group) và nhóm nhược ñộc (attenuated group) (Wu và cs, 2007) [202]. Giữa các chủng trong cùng serotype I có thể có mức ñộ cộng ñồng kháng nguyên không ñều nhau, nhiều trường hợp chủng này chỉ cho 30% miễn dịch chéo với chủng khác. Serotype II bao gồm tất cả các chủng IBDV gây nhiễm và ñược phân lập ở gà tây. Chúng không gây bệnh ở gà nhưng có thể gây nhiễm, cũng tương tự các chủng ở type I không gây bệnh cho gà tây nhưng có thể tồn tại ở gà tây ñể lan truyền trở lại bệnh cho gà. 1.1.2.3 Tính gây bệnh của IBDV Trong tự nhiên: gà nhà và gà tây là hai loại mẫn cảm với virus Gumboro, trong ñó type I gây bệnh cho gà nhà và type II gây bệnh cho gà tây. Người ta cũng ñã phát hiện thấy IBDV ở gà Nhật và chim bồ câu sống hoang dã ở Châu Phi (Kasanga và cs, 2007; 2008) [90, 91]. Một số loài chim hoang dã như vịt trời, ngỗng trời, chim ác là, cũng có thể bị nhiễm virus Gumboro, bị bệnh và chết. Virus Gumboro phân lập từ những loài chim hoang dã này có thể gây bệnh trở lại cho gà mẫn cảm, gây chết tới 60% và làm teo túi Fabricius (Jeon và cs, 2008) [87]. Trong phòng thí nghiệm: khác với một số virus gây bệnh ở ñộng vật khác là có thể gây bệnh dễ dàng trên chính ñộng vật mẫn cảm hoặc trên một số ñộng vật cảm thụ phòng thí nghiệm như chuột lang, chuột bạch, thỏ và một số ñộng vật khác. Với virus Gumboro, ngoài gia cầm mẫn cảm (gà 2 - 6 tuần tuổi), virus chỉ có khả năng gây bệnh trên phôi gà hoặc môi trường tế bào xơ phôi gà mà không có khả năng gây bệnh trên các ñộng vật cảm thụ phòng thí nghiệm. 1.1.3 Cơ chế sinh bệnh Khác với nhiều loại virus gây bệnh ở gia cầm mà cơ quan thích ứng cho sự nhân lên và gây bệnh thuộc về các cơ quan nội tạng hay da, niêm mạc, virus gây bệnh Gumboro lại chọn túi Fabricius - cơ quan có thẩm quyền miễn dịch chủ yếu ở gia cầm làm cơ quan thích ứng cho sự nhân lên và gây bệnh của mình, cụ thể là các tế Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 9 bào lympho B mang thụ thể kháng thể IgG bề mặt và ñại thực bào (Nakai và Hirai, 1981) [142]; (Terasaki và cs, 2008) [187]. Qua con ñường tiêu hóa, do thức ăn, nước uống virus xâm nhập vào hệ tiêu hóa. Tại ñây, chúng ñược các tế bào ñại thực bào tiếp nhận, ñồng thời tiếp xúc với tế bào lympho B còn non là loại mẫn cảm với virus, bắt ñầu thực hiện quá trình nhân lên, quá trình này là sự nhân lên cục bộ, hay sự nhân lên sơ cấp. Chỉ sau 6-8 giờ, một số lượng virus Gumboro ñáng kể ñược giải phóng và xâm nhập vào hệ tuần hoàn. ðây là lần thứ nhất virus xuất hiện trong máu, nhưng người ta không gọi là sự nhiễm trùng máu vì số lượng virus không nhiều. Hệ tuần hoàn chỉ làm nhiệm vụ vận chuyển virus ñi khắp cơ thể mà trước hết là ñến lách, túi Fabricius và một số cơ quan khác. Thông thường 9-11 giờ sau khi vào hệ tiêu hóa, một số lượng lớn virus Gumboro ñã có mặt trong túi Fabricius và bắt ñầu tấn công các loại hình tế bào lympho B, ñây là quá trình nhân lên toàn phần hay sự nhân lên thứ cấp. Số lượng lớn virus Gumboro ñược giải phóng ñã xâm nhập vào hệ tuần hoàn lần thứ hai, lúc này người ta coi sự có mặt của virus Gumboro trong máu là sự nhiễm trùng máu (viremia). Theo Skeeles và cs (1980) [173], virus Gumboro tác ñộng gây nên hiện tượng bệnh lý ñông máu, do vậy trong hệ tuần hoàn xuất hiện các cục huyết khối, làm nghẽn mạch mao quản, chủ yếu là vùng niêm mạc túi Fabricius và ở một số nơi khác, dẫn ñến hiện tượng xung huyết. Khi không chịu nổi áp suất gia tăng của máu, mao mạch bị ñứt gây nên hiện tượng xuất huyết. Sự xuất huyết thường gặp ở các vùng cơ ñùi, cơ lườn thành tia, thành mảng, thành vệt dài và có màu tím, màu hồng, ñồng thời ở túi Fabricius, lách, gan cũng có thể xảy ra trường hợp tương tự. Cứ như vậy, sự xung huyết, xuất huyết từ quy mô nhỏ (từng ñiểm li ti) ñến quy mô lớn (vệt, mảng) và có màu sắc ña dạng từ hồng ñến tím hoặc nâu ñen. Một số biến ñổi bệnh lý trong một số cơ quan có thể dần dần mất ñi và dần phục hồi chức năng vốn có, nhưng ñối với túi Fabricius sự phục hồi không xảy ra. Do virus Gumboro phá hủy túi một cách trầm trọng, virus nhân lên trong tế bào lympho B, phá hủy chúng làm giảm ñáng kể số lượng tế bào này. Số lượng tế bào lympho mất ñi không ñược bù ñắp nên chức năng miễn dịch của túi bị mất một phần hoặc hoàn Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 10 toàn dẫn ñến sự suy giảm miễn dịch (immunosuppression). Mức ñộ suy giảm miễn dịch phụ thuộc vào ñộc lực của virus, thời gian và ñiểm xâm nhập vào cơ thể gà (Hirai và cs, 1979) [72]; (Sharma và cs, 2000) [167]. 1.1.4 Triệu chứng lâm sàng ðối với ñàn gà mẫn cảm, thời gian nung bệnh xảy ra ngắn, khoảng 2-3 ngày: gà ngoẹo ñầu, rúc mỏ vào cánh, có khi gục sang một bên, thích nằm, mắt lim dim mỏi mệt và thường dồn về một góc chuồng, gà kém ăn hoặc bỏ ăn, uống nhiều nước, mất ñịnh hướng, ỉa phân trắng, loãng hoặc toàn nước có khi lẫn máu, lúc ñầu nhiệt ñộ tăng, sau giảm và nếu không qua khỏi thì gà chết trong vòng vài ngày. Do ñặc tính truyền ngang rất mạnh, virus Gumboro gây nên tỷ lệ nhiễm trong ñàn có khi ñạt 100%. Thông thường từ ngày thứ 3 sau triệu chứng lâm sàng ñầu tiên, trong ñàn bắt ñầu có cá thể chết và chết ồ ạt trong vòng 5-7 ngày, sau ñó giảm chết rất nhanh, thường 10-12 ngày có thể dứt bệnh, gà dần hồi phục, tuy nhiên các cá thể bị bệnh qua khỏi thông thường bị tổn thương khá nặng, ñặc biệt là hệ miễn dịch dẫn ñến suy giảm miễn dịch. 1.1.5 Bệnh tích 1.1.5.1 Bệnh tích ñại thể Túi Fabricius: sau 72 giờ bị nhiễm, virus Gumboro có ñộc lực mạnh ñã có thể gây bệnh với bệnh tích ñại thể ñiển hình: túi Fabricius thường sưng rất to, có kích thước và trọng lượng gấp 2-3 lần bình thường. Xung quanh túi có thủy thũng keo nhầy vàng, có khi có bọc dịch thẩm xuất bọc quanh túi Fabricius. Nếu chích hết nước, túi lộ rõ ra, căng tròn, sưng phù. Túi chuyển màu sắc từ vàng sáng sang màu trắng ñục. Túi dễ cấu, dễ bục, các nếp gấp múi khế sưng không rõ nét. Niêm mạc sưng dầy lên làm cho dung tích khoang túi trở nên hẹp lại. ðây là giai ñoạn viêm sưng (Hình 1.4A). Có nhiều cá thể bị bệnh Gumboro, hiện tượng viêm sưng ñi kèm với hiện tượng xuất huyết và thẩm xuất dịch vào trong lòng túi Fabricius, niêm mạc túi có ñiểm xuất huyết, ñôi khi thành vệt, niêm mạc túi chuyển từ màu trắng sang màu thâm tím, nâu ñen (Hình 1.4B). Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 11 Theo Cheville (1967) [49], túi Fabricius bắt ñầu tăng về kích thước và trọng lượng trong khoảng 48-72 giờ sau khi nhiễm do thủy thũng và xuất huyết. Kích thước túi có thể tăng gấp 2-3 lần so với bình thường. Vào ngày thứ 4 sau nhiễm, kích thước túi vẫn còn to gấp ñôi, sau ñó mới nhỏ dần lại. Ngày thứ 5 sau nhiễm trọng lượng túi bằng trọng lượng ban ñầu và sau ñó bắt ñầu teo ñi. ðến ngày thứ 8 trọng lượng túi chỉ bằng 1/3 trọng lượng ban ñầu. A CB Hình 1.4: Bệnh tích túi Fabricius và hệ cơ A: Hình ảnh túi Fabricius sưng to, xung quanh có thủy thũng keo nhầy (Nguồn: www.vemedim.vn/benhvadieutri), B: Hình ảnh xuất huyết bên trong túi (Nguồn: www.medvet.umontreal.ca/.../OrigiInfect/), C: Hình ảnh cơ ñùi, cơ lườn bị xuất huyết ñiểm hoặc thành từng vệt, từng mảng có màu ñỏ hay màu nâu thẫm (Nguồn: Hệ cơ: gà bệnh bị mất nước nên cơ khô rất nhanh, chỉ vài phút sau khi lột da, cơ ngực của gà ñã khô nhăn lại, có mầu thẫm, ñặc biệt có xuất huyết những ñám lấm chấm hoặc thành từng vệt, có khi các vệt xuất huyết hợp lại tạo thành mảng lớn (Hình 1.4C). Ngoài ra, lách có thể bị sưng nhẹ. Gan sưng, bề mặt có những vệt loang lổ mầu vàng, có thể có hoại tử rìa gan, ñôi khi ñiểm hoại tử hợp thành từng vệt nhỏ, mầu vàng sáng ăn sâu vào nội mô của gan. Thận có thể bị sưng, trên bề mặt có những ñiểm xuất huyết, hoại tử. Tuyến ức bị xuất huyết ñiểm, vệt hoặc từng mảng, có khi xuất huyết ăn sâu vào các thùy của tuyến. 1.1.5.2 Bệnh tích vi thể Bệnh tích vi thể xuất hiện sớm ở các cơ quan có cấu trúc từ tổ chức lympho và các cơ quan tạo miễn dịch như túi Fabricius, tuyến ức (thymus), lách, hạch, các mô lympho ở ruột, chỉ trong vòng vài giờ ñến vài chục giờ sau khi virus cường ñộc Gumboro xâm nhập vào cơ thể. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 12 Theo Müller và Lange (1985) [130], có sự tập trung của ñại thực bào và các tế bào lympho trong vòng 4-5 giờ sau khi gây nhiễm qua ñường tiêu hóa và sau 11 giờ xuất hiện những tế bào lympho bị nhiễm virus, nếu gây nhiễm trực tiếp vào túi Fabricius chỉ sau 6 giờ ñã xuất hiện những tế bào lympho bị nhiễm virus. Theo Helmboldt và Garner (1964) [70], 24 giờ sau khi nhiễm các tế bào lympho trong túi Fabricius ñã bị thoái hóa, các tế bào lympho ở vùng tủy của nang ñã bắt ñầu quá trình hoại tử. Virus tấn công và phá hủy các tế bào lympho B non và lympho B trưởng thành, nên chỉ trong thời gian rất ngắn lượng tế bào lympho B ñã giảm ñáng kể (Kim và cs, 2000) [99]. Trung tâm bị hoại tử ngày càng tăng, các vách nang giảm dần, nang bị thu hẹp lại, có các hình tròn, chữ nhật, ô van khác nhau. Các trung tâm hoại tử xuất hiện không bào (vacuole), không còn tế bào lympho hoặc chỉ còn rất ít tập trung ở vùng ngoại vi nang. Thay vào các vị trí của các tế bào lympho là các tế bào heterophil, các mảnh tế bào bị phân hủy một phần, các tế bào hệ lưới nội mô. Toàn bộ các nang lympho bị hủy hoại và có thể quan sát thấy các mức ñộ khác nhau (Kulkarui và cs, 1982) [105] (Hình 1.5). Hình 1.5: Ảnh vi thể của các tế bào ñại thực bào trong túi Fabricius bị virus Gumboro tấn công Ghi chú: A: sự hủy hoại của tế bào ñại thực bào; B: tập hợp virus ñang nhân lên trong tế bào ñại thực bào (Nguồn: ss.niah.affrc.go.jp/disease/EM/em_en/virus0.html) Vào ngày thứ 3 hoặc 4, sự thủy thũng, xung huyết và tập trung của các tế bào của túi làm cho túi Fabricius sưng to. Sự khám phá vai trò của các tế bào T trong miễn dịch bệnh lý ñược gây ra bởi IBDV và sự phục hồi của những mô bị nhiễm ñã cho thấy có sự xâm nhiễm của cả tế bào lympho T (CD4+) và tế bào A B Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 13 lympho T (CD8+) làm cho số lượng lympho T tăng tối ña vào ngày thứ 7 sau khi nhiễm (Kim và cs, 2000) [99]. Các tế bào T ở trong túi Fabricius ngăn cản sự nhân lên của virus trong túi trong giai ñoạn ñầu của bệnh, nhưng cũng thúc ñẩy quá trình phá hủy mô túi và làm chậm quá trình hồi phục của mô thông qua việc giải phóng ra các cytokine gây ñộc tế bào (Rautenschlein và cs, 2002) [154]. Khi phản ứng viêm mất dần, túi Fabricius teo ñi, các nang rỗng phát triển ở vùng tủy nang túi. Có sự hoại tử và thực bào của các tế bào heterophil và tương bào (plasmocyte), có sự xơ hóa của các tế bào phân cách các nang. Sự tăng sinh tế bào nền biểu mô có những ñám dịch nhầy mucin trên bề mặt. 1.1.6 Chẩn ñoán bệnh Có nhiều phương pháp ñể chẩn ñoán bệnh Gumboro ñó là chẩn ñoán bằng phương pháp phân lập virus, chẩn ñoán bằng phương pháp huyết thanh học và hiện nay, chẩn ñoán bằng phương pháp sinh học phân tử sử dụng phản ứng RT-PCR (reverse transcriptase polymerase chain reaction) và Real time PCR (Moody và cs, 2000) [126]. RT-PCR là phương pháp hiện ñại và chính xác, xác ñịnh sự có mặt của một ñoạn gen trong hệ gen virus Gumboro có trong bệnh phẩm; real-time PCR xác ñịnh hàm lượng RNA thông tin của virus Gumboro vừa ñịnh tính vừa ñịnh lượng (Moody và cs, 2000) [126]. Phương pháp chẩn ñoán nhanh bằng miễn dịch học sắc ký (immunochromatographic test, ICT) cũng ñã ñược phát triển và ứng dụng hiện nay (Zhang và cs, 2009) [212]. 1.1.7 Phòng bệnh Gumboro Do ñặc ñiểm cấu tạo ñặc biệt, IBDV có sức ñề kháng rất cao trong tự nhiên, khả năng tồn tại và lan truyền bệnh rất lớn, tính chất dịch tễ bệnh rất phức tạp. Các biện pháp vệ sinh thú y, chăm sóc nuôi dưỡng, kiểm dịch là các biện pháp ñóng góp tích cực trong phòng dịch, song chưa hoàn toàn ngăn ñược bệnh xảy ra. Biện pháp cơ bản ñể khống chế bệnh là tạo miễn dịch cho gà. Do bệnh thường xảy ra ở gà con nên việc tạo miễn dịch cho gà con là vô cùng quan trọng. Có nhiều loại vaccine như vaccine nhược ñộc cho gà con, vaccine vô hoạt nhũ dầu cho gà mẹ. Một loại vaccine “phức hợp miễn dịch - immune complex” ñã ñược Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 14 phát triển, trong ñó các virus vaccine ñược pha trộn với một số lượng các kháng thể tối ưu (Whitfill và cs, 1995) [201] và ñược sử dụng ñể tiêm chủng trong phôi trứng gà (noãn). Tuy nhiên, cơ chế hoạt ñộng chính xác của vaccine “phức hợp miễn dịch” vẫn chưa ñược làm sáng tỏ, người ta cho rằng “phức hợp miễn dịch” làm gia tăng các tế bào tua và ñại thực bào trong nang túi Fabricius, nơi virus tồn tại cho ñến khi giảm lượng kháng thể nhận ñược từ mẹ (Jeurissen và cs, 1998) [88]. Một số loại vaccine vector tái tổ hợp thế hệ mới sử dụng các virus dẫn truyền gen kháng nguyên VP2 hoặc toàn bộ phân ñoạn A của virus Gumboro ñã ñược thử nghiệm ñó là các loại vaccine có vector dẫn truyền chứa gen kháng nguyên virus Gumboro, cụ thể là vector virus ñậu gà (Shaw và Davison 2000) [169], vector virus herpes của gà tây (Tarpey và cs, 2007) [186], vector adenovirus ở gà (Francois và cs, 2001) [66]; (Perozo và cs, 2008) [149], vector virus gây bệnh Marek (Tsukamoto và cs, 2002) [191] và vector virus Forest Semliki (Phenix và cs, 2001) [151], hay sử dụng bacteriophage T4 (Cao và cs, 2005) [45]. Protein VP2 ñược biểu hiện trong hệ thống baculovirus riêng biệt (Dybing và Jackwood, 1998) [59]; (Yehuda và cs, 2000) [209] hoặc cùng với cytokine IL-6 (Liu và cs, 2005) [115]; các tiểu phần cấu tạo (giống hạt virus) tương tự virus ñược biểu hiện trong tế bào côn trùng (VLP = virus- like particle) của IBDV (Hu và cs, 1999) [75]; (Kibenge và cs, 1999) [98], tất cả các loại hình này cũng ñược coi là các vaccine mới cung cấp kháng nguyên miễn dịch trong ñịnh hướng phát triển vaccine phòng chống Gumboro. Một loại hình vaccine thế hệ mới khác là vaccine DNA cũng ñược sử dụng cho việc phòng chống ñối với IBDV, ñó là plasmid ñược thiết kế chứa gen kháng nguyên của virus Gumboro (Kim và cs, 2004) [101]; (Mahmood và cs, 2007) [121]; (Sun và cs, 2005) [180], công nghệ ứng dụng vaccine dạng này ở Việt Nam cũng ñã ñược tiến hành nghiên cứu (Lê Thanh Hòa, 2006a) [18], cũng như vaccine tái tổ hợp gen kháng nguyên VP2 ñã ñược sản xuất và sử dụng trên quy mô lớn (Pitcovski và cs, 2003) [152]; (Rong và cs, 2005; 2007) [159, 160]. Một phương thức mới dựa trên công nghệ cao ñã ñược thử nghiệm ñó là liệu pháp phá bỏ gen RNA thông tin VP2 của virus Gumboro thông qua cơ chế can thiệp RNA (RNA interference, RNAi) nhờ Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 15 vector dẫn truyền adeno-associated virus (Sun và cs, 2009) [181]; (Wang và cs, 2009) [199]. 1.2 SINH HỌC PHÂN TỬ VIRUS GUMBORO Các virus thuộc họ Birnaviridae có hệ gen chứa RNA 2 sợi (dsRNA = double stranded RNA), ñược phân làm hai ñoạn A và B, nằm trong vỏ capsid 20 mặt, cấu tạo ñơn giản không có màng bao ngoài, ñường kính khoảng 60 nm, bao gồm virus gây viêm túi Fabricius truyền nhiễm hay virus Gumboro gây bệnh ở gà trong nhóm Avibirnavirus, virus gây hoại tử tuyến tụy của cá (Infectious pancreatic necrosis virus = IPNV), Tellina virus (TV), Oyster virus (OV), Crab virus của loài nhuyễn thể trong nhóm Aquabirnavirus và virus X ruồi dấm (Drosophila X virus = DXV) trong nhóm Entomobirnavirus (Murphy và cs, 1995) [140] (Hình 1.6). A B C Hình 1.6: Các hạt virus nhìn dưới kính hiển vi ñiện tử A: Virus gây hoại tử tuyến tuỵ của cá (IPNV) (Nguồn: www.veths.no/.../Research/Aquatic- medicine/). B: Virus X ruồi dấm (DXV) (Nguồn: www.umbi.umd.edu/~wul/). C: Virus Gumboro (IBDV) (Nguồn: 210.36.18.48/gxujingpin/dwwswx/ev/16.htm) ðối tượng cảm nhiễm của IPNV là cá hồi thuộc loại salmon, một loại cá lưỡng cư nước mặn và ngọt, mặc dù virus IPNV cũng ñược phân lập từ cá sống hoàn toàn ở nước ngọt hoặc hoàn toàn ở nước mặn. Virus có khả năng truyền ngang và truyền dọc, không có bằng chứng ñược truyền qua vector sinh học. Phân bố của virus khắp thế giới, gây bệnh nặng thành dịch ở các ñàn cá giống và cá con mới nở vài ngày tuổi. Bệnh tích ñặc trưng là hoại tử ở tuyến tuỵ, và cũng có bệnh tích tuy chưa có hoại tử ở thận, gan, tinh hoàn, buồng trứng, ruột, não v.v... Cá bị nhiễm nếu không phát triển thành bệnh, không biểu hiện lâm sàng và bệnh tích, và trở thành vật mang trùng nguy hiểm. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 16 ðối tượng trong tự nhiên có cảm nhiễm của virus DXV là ruồi dấm, Drosophila melanogaster. Virus lây truyền theo phương thức truyền ngang, và không có vector trung gian. Phân bố ñịa lý của DXV chưa ñược xác ñịnh. Ruồi dấm bị nhiễm bệnh thường có ñộ mẫn cảm cao với khí carbonic (CO2). ðích tấn công và bệnh lý tổ chức học còn chưa rõ. ðối tượng cảm nhiễm tự nhiên của virus Gumboro (IBDV) là gà và gà tây. Rất hạn hữu, IBDV phân lập ñược từ vịt, và các loại chim nuôi, gia cầm cảnh khác. Truyền ngang vẫn là phương thức chính, không có sự trung gian của vector. Phân bố IBDV rộng khắp thế giới, ñích tấn công là túi Fabricius, tế bào Lympho-B, gây suy giảm miễn dịch. Gà cảm nhiễm ở lứa tuổi 3-6 tuần, chết do viêm túi Fabricius, do hậu quả phức hợp miễn dịch bệnh lý, do nghẽn mạch máu và các rối loạn tuần hoàn và cơ quan có bệnh tích. 1.2.1 Hệ gen của virus Gumboro ðặc ñiểm hệ gen của virus là phân tử RNA sợi ñôi (dsRNA=double stranded RNA) chứa hai phân ñoạn có tên gọi là phân ñoạn A và phân ñoạn B (Müller và cs, 1979) [128] (Hình 1.7). Hiện nay người ta ñã xác ñịnh hoàn chỉnh trình tự nucleotide của 2 phân ñoạn gen A (có ñộ dài khoảng 3.200 bp) và B (có ñộ dài khoảng 2.800 bp) (Kim và Yeo, 2003) [100]; (Kong và cs, 2004) [102]; (Mundt và Müller, 1995a) [139]; (Petkov và cs, 2007) [150], và ñã có nhiều trình tự dữ liệu nucleotide của nhiều chủng IBDV ñã ñược xác ñịnh và lưu trữ trong Ngân hàng gen. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 17 Hình 1.7: Hệ gen của virus Gumboro bao gồm 2 phân ñoạn A và B nhìn dưới kính hiện vi ñiện tử (Nguồn: Lê Thanh Hòa, 2003c [16]) Trình tự nucleotide của phân ñoạn A của một số chủng virus thuộc serotype I (Brown và Skinner, 1996) [43]; (Hosseini và cs, 2004) [74]; (Hudson và cs, 1986) [76] và serotype II (Kibenge và cs, 1991) [94] cũng như phân ñoạn B của các chủng thuộc serotype I (Morgan và cs, 1998) [127], và các chủng thuộc serotype II (Kibenge và cs, 1996) [95] ñã ñược giải mã và công bố. Vùng trình tự mã hóa của phân ñoạn B có sự tồn tại mức ñộ tương ñồng tương ñối cao về nucleotide (89%) và amino acid (93-98%) (Brown và Skinner, 1996) [43], ở cả các chủng gây bệnh thuộc serotype I và không gây bệnh thuộc serotype II. Trình tự các motif của RNA polymerase phụ thuộc RNA virus (RdRp) ñược bảo tồn trong cả hai serotype của IBDV (Hình 1.8). Trong phân ñoạn A, sự tương ñồng thấp hơn về nucleotide và amino acid tương ứng là 83%-84% và 90% ñáng chú ý ở các vùng mã hóa giữa các chủng thuộc serotype I và II (Kibenge và cs, 1991) [94]. ðiều này chủ yếu xảy ra tại vùng “siêu biến ñổi” liên quan tới các epitope ñặc hiệu của từng serotype virus trong protein cấu trúc VP2 (Kibenge và cs, 1991; 1999) [94, 98]. Toàn bộ các trình tự không mã hóa ñầu 5' và 3' của phân ñoạn A và B ở các chủng thuộc serotype I và các chủng thuộc serotype II của IBDV ñã ñược giải mã và công bố (Kibenge và cs, 1996) [95]; (Mundt và Müller, 1995a) [139]. Trình tự ñầu tận cùng 5' trong cả hai phân ñoạn gen VP4 VP3 13'NC ñều tồn tại một trình tự Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 18 bảo tồn gồm 32-nucleotide là GGA U(A/G)C GAU (C/G)GG UCU GAA CC(c/u) C(G/U)G G(GI-)A GUC AC (Hình.1.8). Vùng ưa nước 1 và 2 Trình tự bảo tồn 32 N ởñầu 5’ NC Trình tự bảo tồn 5 N ởñầu 3’ NC Vùng heptapeptide ngay sát h2 Gắn thêm 1 aa giữa h1, h2 Xoá ñi 1 aa RdRp Trình tự bảo tồn RNA phụ thuộc RNA polymerase IBDV serotype I IBDV serotype II Phân ñoạn A hệ gen Phân ñoạn B hệ gen STI STII STI STII STI STII Hình 1.8: Sơ ñồ hệ gen và một số vùng quan trọng của IBDV serotype I và II Các trình tự ñầu tận cùng 3’của cả hai phân ñoạn của các chủng IBDV ñược kết thúc với một trình tự gồm 5 nucleotide bảo tồn -GCGGU- (Kibenge và cs, 1996) [95]. Như vậy, ñầu tận cùng của các phân ñoạn này ở hệ gen IBDV giống với các phân ñoạn khác của các virus RNA khác như Reovirus (Antczak và cs, 1982) [30] và Influenza virus (Stockle và cs, 1987) [178] nơi có ñầu 5’ và 3’ tương ứng nằm giữa các phân ñoạn của hệ gen. Tại ñầu tận cùng 5' và 3' trong cả hai phân ñoạn hệ Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 19 gen của IBDV, có các cấu trúc tận cùng thẳng và lặp ñược cho là chứa ñựng các tín hiệu quan trọng cho sự nhân lên, sao chép và bao gói virus. Ngay sát các cấu trúc lặp ở ñầu tận cùng 3' trên phân ñoạn A và 5’ trên phân ñoạn B có khả năng tạo thành các cấu trúc bậc hai hình vòm (loop) và mầm (stem) (Kibenge và cs, 1996) [95]. Các cấu trúc vòm và mầm là những cấu trúc có liên quan trong quá trình sao chép RNA, dịch mã và khép vỏ của các virus chứa RNA khác như virus bại liệt (Simoes và Sarnow, 1993) [172]. Trong phân ñoạn A của IBDV, có sự khác nhau giữa các chủng thuộc serotype I và II trong các cấu trúc bậc hai ñược tạo ra bởi vùng 5' không mã hóa phía trước gen VP5; những cấu trúc này có thể liên quan trong quá trình nhân lên của virus, trong nhận diện tế bào chủ ñặc hiệu và có lẽ cả tính gây bệnh (Mundt và Müller, 1995a) [139]. Hai phân ñoạn A và B của IBDV cũng chứa ñựng những sự thay ñổi nuleotide ñặc hiệu với từng serotype trong các vùng không mã hóa. Khi so sánh các chủng IBDV thuộc serotype II với các chủng thuộc serotype I, ñã có sự thay ñổi về nucleotide trong vùng 5' không mã hóa mà ñặc trưng cho serotype trên phân ñoạn A, và trên phân ñoạn B (Kibenge và cs, 1996) [95]. Không có sự thay ñổi ñặc trưng cho serotype ñược tìm thấy trong trình tự ñầu tận cùng 3' của phân ñoạn A, rất ít thay ñổi nuleotide ñược xác ñịnh trong trình tự ñầu tận cùng 3' của phân ñoạn B (Kibenge và cs, 1996) [95]. 1.2.2 Protein của virus - cấu trúc và chức năng Hai phân ñoạn RNA của IBDV ñều mang thông tin di truyền và có nhiệm vụ sinh tổng hợp 5 loại protein có tên gọi là VP1, VP2, VP3, VP4 và VP5. (Hình 1.9). Phân ñoạn A (segment A) của hệ gen virus Gumboro có bao gồm hai khung ñọc mở (ORF = Open Reading Frame). Một khung ñọc mở lớn mã hóa cho một tiền protein, gọi là protein chung (polyprotein) có phân tử lượng là 108 kDa, mà trong quá trình tiếp theo sẽ ñược phân cắt thành các polypeptide riêng biệt, là những protein cấu trúc, có tên gọi là VP2, VP4, VP3 (Azad và cs, 1987) [31]; (Becht và cs, 1988) [35], (Hudson và cs, 1986) [76]; (Kibenge và cs, 1997) [97]. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 20 Hình 1.9: Các phân ñoạn A và B của hệ gen virus Gumboro qua ñiện di DNA (trái); và các thành phần protein qua ñiện di protein (phải) Ghi chú: A: Virus Gumboro chỉ có 2 phân ñoạn RNA là phân ñoạn A và phân ñoạn B, trong khi một loại virus chứa RNA khác, virus Reo (Reo3) chứa tới 9 phân ñoạn. B: Một số thành phần protein của virus Gumboro, trong ñó có VP1, VP2a và VP2b, VP3, VP4. Cột bên cạnh là chỉ thị di truyền protein (marker) (Nguồn: www.weblo.com/domain/available/kda1969.com/ VP2 là ñoạn RNA ñầu tiên trong chuỗi gen hợp nhất VP2-4-3 mã hóa cho protein chung của phân ñoạn A. Toàn bộ chuỗi nucleotide mã hóa cho protein chung VP2-4-3 của phân ñoạn A có ñộ dài 3039 bp, bao gồm cả bộ mã khởi ñầu ATG (của VP2) và bộ mã kết thúc TGA (của VP3), sau khi tổng hợp, polypeptide sắp xếp theo trật tự: NH2-pVP2-VP4-VP3-COOH (Ye và cs, 2007) [208]. Từ ñó, nhờ hoạt ñộng của VP4 là enzyme protease, polypeptide chung này tự phân cắt thành VP2 nguyên thủy (pVP2, còn gọi là VPX) có trọng lượng phân tử là 48 kDa, VP3 (28 kDa) và VP4 (32 kDa) (Lejal và cs, 2000) [111]. Cuối cùng, polypeptide VP2 (VPX) ñược tém gọn lại tại ñầu C (carboxyl, -COOH), ñể tạo nên VP2 trưởng thành có trọng lượng 37 kDa (Da Costa và cs, 2002) [51]. VP2 và VP3 là hai loại protein cấu trúc, sau khi ñược phân cắt thành sản phẩm ñộc lập, các protein này ñược lắp ghép lên bề mặt virion tạo nên hai lớp ngoài và trong của cấu trúc capsid của virus (Oña và cs, 2004) [146]. VP2 có ñộ dài 1.356 bp, có bộ mã khởi ñầu ATG nhưng không có bộ mã kết thúc vì tiếp nối vào ñó là chuỗi nucleotide của VP4 (Jackwood và Sommer- Wagner, 2007) [85]. Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 21 Ở protein VP2 có sự liên quan tồn tại của một sản phẩm tiền phân cắt, ñó là một protein lớn hơn VP2 (pVP2) có thể ñược tìm thấy trong các tế bào nhiễm, sau ñó ñược phân cắt thành VP2 có hoạt tính ở trong hạt virus hoàn chỉnh (._..................T.................... : 2420 HK46 : ..C.............................G...........G.....C...................A..................T.................T.. : 2420 SH-92 : ..C.............................G........C..G.....C...................A..................T.................... : 2420 OKYM : ..C.............................G...........G.....C...................A..................T.................... : 2420 Harbin-1 : ..C.............................G.....T.....G.........................AA..............C....................... : 2420 NB : ................................G...........G.....C...................A..................T.................... : 2420 * 2440 * 2460 * 2480 * 2500 * 2520 * 52-70 : CGACCCGAACGCCCATCGGGTGCGAAATTTTCTTGCAAACGCACCACAAGCAGGCAGCAAGTCGCAAAGGGCCAAGTACGGGACAGCAGGCTACGGAGTGGAGGCTCGGG : 2530 Cu1 : ...................A.......................................................................................... : 2530 D78 : ...................A.......................................................................................... : 2530 CS-2-35 : ...................A.......................................................................................... : 2530 GLS : ...................A.......C..........................T........T...........A.............................C.... : 2530 STC : ...................A.............................................................C.......................C.... : 2530 IM : ...................A......................G..............................................................C.... : 2530 BDG23 : .........T..A......A....C........C.................................C.A................................A..C.... : 2530 GHUT-12 : ...................A....T..C.....C...................................A..............G.....T................... : 2530 G202 : ...................A....C........C..............G....................A...................................C.... : 2530 HK46 : ...................A....C........C...................................A...................................C.... : 2530 SH-92 : ...................A....C........C...................................A...................................C.... : 2530 OKYM : .........T.........A....C........C...................................A...................................C.... : 2530 Harbin-1 : ...................A....C........C...................................A...................................C.... : 2530 NB : ...................A....C........C...................................A...................................C.... : 2530 ▼ Kết thúc gen VP4 193 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 193 2540 * 2560 * 2580 * 2600 * 2620 * 2640 52-70 : GCCCCACACCAGAGGAAGCACAGAGGGAAAAAGACACACGGATCTCAAAGAAGATGGAGACCATGGGCATCTACTTTGCAACACCAGAATGGGTAGCACTCAATGGGCAC : 2640 Cu1 : .............................................................................................................. : 2640 D78 : .............................................................................................................. : 2640 CS-2-35 : .............................................................................................................. : 2640 GLS : .............A................................................................................................ : 2640 STC : ...........................C.................................................................................. : 2640 IM : .............................................................T................................................ : 2640 BDG23 : .......T........G............................................G................................................ : 2640 GHUT-12 : .......T....................G..............T..........................................................G....... : 2640 G202 : .......T.....................................................T................................................ : 2640 HK46 : .......T.....................................................T.........................................C...... : 2640 SH-92 : .......T.....A............................................................................................A... : 2640 OKYM : .......T..........T........................................G.T................................................ : 2640 Harbin-1 : .......T.............................................G.......T................................................ : 2640 NB : .......T.....A...............................................T................................................ : 2640 * 2660 * 2680 * 2700 * 2720 * 2740 * 52-70 : CGAGGGCCAAGCCCCGGCCAGCTAAAGTACTGGCAGAACACACGAGAAATACCGGACCCAAACGAGGACTATCTAGACTACGTGCATGCAGAGAAGAGCCGGTTGGCATC : 2750 Cu1 : .............................................................................................................. : 2750 D78 : .............................................................................................................. : 2750 CS-2-35 : .............................................................................................................. : 2750 GLS : .............................................................................................................. : 2750 STC : ..............G.C............................................................................................. : 2750 IM : .............................................................................................................. : 2750 BDG23 : ..G...........T......................................T..T..............C...................................... : 2750 GHUT-12 : ..G..................................................T..T..............C...................................... : 2750 G202 : ..G..................................................T..T..............C...................................... : 2750 HK46 : ..G.....G............................................T..T..............C...................................... : 2750 SH-92 : ..G..................................................T..T..............C...................................... : 2750 OKYM : ..G..................................................T..T..............C...................................... : 2750 Harbin-1 : ..G....................G.............................T..T..............C...................................... : 2750 NB : ..G..................................................T..T..............C...................................... : 2750 2760 * 2780 * 2800 * 2820 * 2840 * 2860 52-70 : AGAAGAACAAATCCAAAGGGCAGCTACGTCGATCTACGGGGCTCCAGGACAGGCAGAGCCACCCCAAGCTTTCATAGACGAAGTTGCCAAAGTCTATGAAATCGACCATG : 2860 Cu1 : ..............T........................................................................................A...... : 2860 D78 : ..............T........................................................................................A...... : 2860 CS-2-35 : ..............T...................................................G....................................A...... : 2860 GLS : ..............T........................................................................................A...... : 2860 STC : .............TT..A..................................................................A..................A...... : 2860 IM : ..............T..A..................................................................C..................A...... : 2860 BDG23 : ..............T...................................................G..C..............C........T.........A...... : 2860 GHUT-12 : ..............T.......................................T...........G..C..............C..................A...... : 2860 G202 : ..............T...................................G...............G..C..............C........T.........A...... : 2860 HK46 : ..............T......G............................................G..C..T........G..C..................A...... : 2860 SH-92 : ..............T...................................................G..C..............C..................A...... : 2860 OKYM : ..............T...................................................G..C..............C..................A...... : 2860 Harbin-1 : ..............T......................................................C..............C..................A...... : 2860 NB : ..............T...................................................G..C..............C........T.........A...... : 2860 * 2880 * 2900 * 2920 * 2940 * 2960 * 52-70 : GACGTGGCCCAAACCAAGAACAGATGAAAGATCTGCTCTTGACTGCGATGGAGATGAAGCATCGCAATCCCAGGCGGGCTCTACCAAAGCCCAAGCCAAAACCCAATGCT : 2970 Cu1 : .............................................................................................................. : 2970 D78 : .............................................................................................................. : 2970 CS-2-35 : .................................................................................................G............ : 2970 GLS : .................................................................................C.................G......C... : 2970 STC : .G...................................................C...........................C............................ : 2970 IM : .................................................................................C............................ : 2970 BDG23 : .G........C......................................................................C..........................T. : 2970 GHUT-12 : .G........C........G.................T...........................................C............................ : 2970 G202 : .G........C.....T..G.............................................................C..........................T. : 2970 HK46 : .G........C......................................................................C..........................T. : 2970 SH-92 : .G........C.........................C............................................C..........................T. : 2970 OKYM : .G........C......................................................................C..........................T. : 2970 Harbin-1 : .G........C......................................................................C..........................T. : 2970 NB : .G........C......................................................................C..........................T. : 2970 2980 * 3000 * 3020 * 52-70 : CCAACACAGAGACCCCCTGGTCGGCTGGGCCGCTGGATCAGAACCGTCTCTGATGAGGACCTTGAGTGA : 3039 Cu1 : .........................................G........................... : 3039 D78 : ..............T..........................G........................... : 3039 CS-2-35 : .........................................G........................... : 3039 GLS : .....G...................................G..T........................ : 3039 STC : .........................................G..T........................ : 3039 IM : .........................................G..T........................ : 3039 BDG23 : .........................................GG.T........................ : 3039 GHUT-12 : .........................................GG.T........................ : 3039 G202 : .........................................GG.T........................ : 3039 HK46 : ..............T..........................GG.T........................ : 3039 SH-92 : .........................................GG.T........................ : 3039 OKYM : .........................................GG.T........................ : 3039 Harbin-1 : .........................................GG.T........................ : 3039 NB : .........................................GG.T........................ : 3039 194 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 194 b. Amino acid * 20 * 40 * 60 * 80 * 100 * 52-70 : MTNLQDQTQQIVPFIRSLLMPTTGPASIPGDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRS : 110 Cu1 : .............................D................................................................................ : 110 D78 : .............................D................................................................................ : 110 CS-2-35 : .............................D................................................................................ : 110 GLS : .............................D................................................................................ : 110 STC : .............................D.................................................L.............................. : 110 IM : .............................D................................................................................ : 110 BDG23 : ..........................P..D.............................S.................................................. : 110 GHUT-12 : .............................D................................................................................ : 110 G202 : ..........................P..D................................................................................ : 110 HK46 : .............................D................................................................................ : 110 SH-92 : .............................D................................................................................ : 110 OKYM : .............................D................................................................................ : 110 Harbin-1 : .............................D................................................................................ : 110 NB : .............................D................................................................................ : 110 120 * 140 * 160 * 180 * 200 * 220 52-70 : STLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQY : 220 Cu1 : .............................................................................................................. : 220 D78 : .............................................................................................................. : 220 CS-2-35 : .............................................................................................................. : 220 GLS : .............................................................................................................. : 220 STC : .............................................................................................................. : 220 IM : .............................................................................................................. : 220 BDG23 : ..............................................................................................I...........L... : 220 GHUT-12 : .............................................................................E.......................N........ : 220 G202 : ..................................................R..........................E.......................N........ : 220 HK46 : .............................................................................................................. : 220 SH-92 : .............................................................................................................. : 220 OKYM : .............................................................................................................. : 220 Harbin-1 : .............................................................................................................. : 220 NB : .............................................................................................................. : 220 * 240 * 260 * 280 * 300 * 320 * 52-70 : QPGGVTITLFSANIDAITSLSVGGELVFQTSVHGLVLGATIYLIGFDGTAVITRAVAANSGLTTGTDNLLPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSAR : 330 Cu1 : .................................................T.........N.........M......S................................K : 330 D78 : ...........................................................N.................................................. : 330 CS-2-35 : ................................Q...............AT.........N.........M........................................ : 330 GLS : .T..........................K...QS..............S..........N...A.....M..............................E........S : 330 STC : ................................Q.........F......T........DN...A.....M.....................V.................S : 330 IM : .....................I..........Q.........................DN...A.....M.......................................S : 330 BDG23 : ................................Q................T........DN...A.....M...I...................................S : 330 GHUT-12 : .A...................I..........Q..I......................DN...A.....M...I....S.......................N......S : 330 G202 : .A...................I..........Q..I......................DN...A.....M...I....S..............................S : 330 HK46 : .A...................I..........Q..I......................DN...A.....M...I....S..............................S : 330 SH-92 : .A...................I..........Q..I.......................N...A.....M...I....S..............................S : 330 OKYM : .A...................I..........Q..I......................DN...A.....M...I....S..............................S : 330 Harbin-1 : .A...................I..........Q..I......................DN...A.....M...I....S........................K.....S : 330 NB : .A...................I.............I.............E........DN.........M...I....S..............................S : 330 340 * 360 * 380 * 400 * 420 * 440 52-70 : GSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAG : 440 Cu1 : .............................................................................................................. : 440 D78 : .............................................................................................................. : 440 CS-2-35 : .............................................................................................................. : 440 GLS : ......................................................................................................S....... : 440 STC : .............................................................................................................. : 440 IM : .............................................................................................................. : 440 BDG23 : .....................................................I........................................................ : 440 GHUT-12 : .....................................................I........................................................ : 440 G202 : .............................................................................................................. : 440 HK46 : .............................................................................................................. : 440 SH-92 : .............................................................................................................. : 440 OKYM : .............................................................................................................. : 440 Harbin-1 : .............................................................................................................. : 440 NB : .............................................................................................................. : 440 VP2 VPx 460 * 480 * 500 VPx VP4 520 * 540 * 52-70 : AFGFKDIIRAIRRIAVPVVSTLFPPAAPLAHAIGEGVDYLLGDEAQAASGTARAASGKARAASGRIRQLTRAADKGYEVVANLFQVPQNPVVDGILASPRVLRGAHNLDC : 550 Cu1 : ......................................................................L............................G.......... : 550 D78 : ......................................................................L............................G.......... : 550 CS-2-35 : ......................................................................L............................G.......... : 550 GLS : ......................................................................L............................GI......... : 550 STC : ......................................................................L............................G.......... : 550 IM : ......................................................................L.....H......................G.......... : 550 BDG23 : ..........L...........................................................L............................GI......... : 550 GHUT-12 : ..........L...........................................................L............................GI......... : 550 G202 : ..........L...........................................................L............................GI......... : 550 HK46 : ..........L.................................T.........................L............................GI......... : 550 SH-92 : ..........L................................................S..........L............................GI......... : 550 OKYM : ..........L...........................................................L............................GI......... : 550 Harbin-1 : ..........L...........................................................L.........T..................GI......... : 550 NB : ..........L...........................................................L............................GI......... : 550 560 * 580 * 600 * 620 * 640 * 660 52-70 : VLREGATLFPVVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPGGVLPLETGRDYTVVPIDDVWDDSIMLSKDPIPPIVGNSGNLAIAYM : 660 Cu1 : ...............................................................D.............................................. : 660 D78 : ...............................................................D.............................................. : 660 CS-2-35 : ...............................................................D.............................................. : 660 GLS : ...............................................................D.............................................. : 660 STC : ............................I..................................D.............................................. : 660 IM : .....................................K.........................D.............................................. : 660 BDG23 : ...............................................................D.............................................. : 660 GHUT-12 : ...............................................................D.............................................. : 660 G202 : .......................................F.......................D.............................................. : 660 HK46 : ...............................................................D.......................................T...... : 660 SH-92 : ...............................................................D............................................-. : 659 OKYM : ...............................................................D.............................................. : 660 Harbin-1 : ...............................................................D.......................V...................... : 660 NB : ...............................................................D.......R...................................... : 660 ▼ ▼ 194 * 680 * 700 * 720 * 740 * VP4 VP3 * 52-70 : DVFRPKVPIHVAMTGALNACGEIEKVSFRSTKLATAHRLGLKLAGPGAFDVNTGPNWATFIKRFPHNPRDWDRLPYLNLPYLPPNAGRQYHLAMAASEFKETPELESAVR : 770 Cu1 : .............................................................................................................. : 770 D78 : .............................................................................................................. : 770 CS-2-35 : .........................................R.................................................................... : 770 GLS : .........................I.................................................................................... : 770 STC : ...................F.......................................................................................... : 770 IM : .............................................................................................................. : 770 BDG23 : ...................Y....N...........................A.S...................................D................... : 770 GHUT-12 : ...................Y....N...K.........................S........................S..........D......K............ : 770 G202 : ...................Y....N.............................S..........................F........D................... : 770 HK46 : ...................Y....N.............................S...................................D................... : 770 SH-92 : ...-...............Y....N.............................S...................................D.........G......... : 768 OKYM : ...................Y....N.............................S...................................D................... : 770 Harbin-1 : ...................Y....N.............................S...................................D................... : 770 NB : ...................Y....N.............................S..........R........................D................... : 770 780 * 800 * 820 * 840 * 860 * 880 52-70 : AMEAAANVDPLFQSALSVFMWLEGNGIVTDMANFALSDPNAHRVRNFLANAPQAGSKSQRAKYGTAGYGVEARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGH : 880 Cu1 : .......................E...................M.................................................................. : 880 D78 : .......................E...................M.................................................................. : 880 CS-2-35 : .......................E...................M.................................................................. : 880 GLS : ......S................E...................M.................................................................. : 880 STC : .......................E...................M......................................A........................... : 880 IM : .......................E...................M.................................................................. : 880 BDG23 : .......................E...........F.......M.................................................................. : 880 GHUT-12 : .......................E........D..F.......M...............................................................S.. : 880 G202 : .......................E...................M.................................................................. : 880 HK46 : .......................E...................M.................................................................. : 880 SH-92 : .......................E...................M.................................................................. : 878 OKYM : .......................E...................M...................................V.............A................ : 880 Harbin-1 : ............H..........E...................M...............................................V.................. : 880 NB : .......................E...................M.................................................................. : 880 * 900 * 920 * 940 * 960 * 980 * 52-70 : RGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQIQRAATSIYGAPGQAEPPQAFIDEVAKVYEIDHGRGPNQEQMKDLLLTAMEMKHRNPRRALPKPKPKPNA : 990 Cu1 : .........................................L.............................N...................................... : 990 D78 : .........................................L.............................N...................................... : 990 CS-2-35 : .........................................L.............................N...................................... : 990 GLS : .........................................L.............................N............................P.....R... : 990 STC : .....A...................................LK............................N...................L........P......... : 990 IM : .........................................LK............................N............................P......... : 990 BDG23 : .........................................L.............................N............................P........V : 990 GHUT-12 : .........................................L.............................N............................P......... : 990 G202 : .........................................L...........R.................N......H.....................P........V : 990 HK46 : .........................................L.............................N............................P........V : 990 SH-92 : .........................................L.............................N.............P..............P........V : 988 OKYM : .........................................L.............................N............................P........V : 990 Harbin-1 : .........................................L.............................N............................P........V : 990 NB : .........................................L.............................N............................P........V : 990 1000 * 52-70 : PTQRPPGRLGRWIRTVSDEDLE- : 1012 Cu1 : ......................- : 1012 D78 : ......................- : 1012 CS-2-35 : ......................- : 1012 GLS : ......................- : 1012 STC : ......................- : 1012 IM : ......................- : 1012 BDG23 : ..............A.......- : 1012 GHUT-12 : ..............A.......- : 1012 G202 : ..............A.......- : 1012 HK46 : ..............A.......- : 1012 SH-92 : ..............A.......- : 1010 OKYM : ..............A.......- : 1012 Harbin-1 : ..............A.......- : 1012 NB : ..............A.......- : 1012 ▼ ._.

Các file đính kèm theo tài liệu này:

  • pdfCH2106.pdf
Tài liệu liên quan